£24.47 with offer

IGF1-LR3 1mg

£34.95

IGF-1 LR3 is a specialised research peptide developed for advanced scientific investigation of insulin-like growth factor receptor (IGF-1R) signalling, growth factor–mediated pathways, and downstream intracellular regulatory mechanisms.

OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 99 % (HPLC, typical)
CAS Number: 946870-92-4
Molecular Formula: C400H625N111O115S9

Volume Pricing
Spend £150+ (20% off)£27.96
Spend £500+ (30% off)£24.47

Spending over £1000? Email us your order and we will custom price.

  • Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Long-R3 IGF-1, 83 aa; 3 intramolecular disulfide bonds)
(133 customer reviews)

In stock

Add to Cart
OP Labs IGF-1 LR3 1mg research peptide lyophilized powder in glass vial
IGF1-LR3 1mg
£34.95

Free shipping on orders over £20

  • Royal Mail Tracked24
  • Order before 16.00 for same day dispatch
  • Money Back Guarantee
Guaranteed Safe Checkout

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden.

IGF-1 LR3 (Long R3 IGF-1)
Certificate of Analysis (representative)

Representative specimen data. These are typical results for this product. Actual results are batch-specific and are printed on the certificate for the batch number on your vial. Research use only.

IGF-1 LR3 (Long R3 IGF-1) — representative Certificate of Analysis (specimen)
ParameterResult
Product nameIGF-1 LR3 (Long R3 IGF-1)
CAS number946870-92-4
Molecular formulaC400H625N111O115S9
Molecular weight9117.5 g/mol
AppearanceWhite to off-white powder
Test methodRP-HPLC (C18), UV detection at 220 nm
Purity (HPLC)98.56% (specification ≥ 98.5%)
Mass-spec identityESI-MS (positive): [M+7H]7+ 1303.5, confirming 9117.5 g/mol
Water content3.8% (Karl Fischer, specification ≤ 10.0%)
Analysis dateRepresentative specimen — the analysis date is printed on each batch certificate

Download the specimen certificate (PDF)

  • OP Labs formerly Oxford Peptides
  • Batch HPLC tested at 98.5%+ purity
  • Store frozen long term or in fridge when ready to be used
  • Sold for research purposes only
  • Contact us for Wholesale Orders

Search our database for full COA analytics here.

IGF-1 LR3

Synonyms / Designations: IGF-1 LR3, Long Arg³ IGF-1, Insulin-Like Growth Factor-1 LR3, Recombinant IGF-1 analogue
CAS Number: 946870-92-4
Molecular Formula: C400H625N111O115S9
Molecular Weight: 9117.5 g/mol
Peptide Classification: Synthetic analogue of insulin-like growth factor-1 (IGF-1)
Purity: ≥ 99 % (HPLC, typical)
Appearance: White to off-white lyophilised powder
Pack Size: 1 mg (total)
Storage: Desiccated, protected from light, stored at –20 °C
Solubility: Soluble in sterile water and buffered aqueous solutions

Description & Mechanism

IGF-1 LR3 is a synthetic analogue of human insulin-like growth factor-1 (IGF-1) incorporating an arginine substitution at position 3 and an extended N-terminal sequence. These structural modifications reduce affinity for endogenous IGF binding proteins, resulting in altered stability and interaction characteristics in experimental systems compared to native IGF-1.

In biochemical and cellular research models, IGF-1 LR3 interacts with the IGF-1 receptor (IGF-1R), initiating intracellular signalling cascades associated with growth factor–mediated pathways. Research studies commonly examine receptor binding behaviour, downstream signalling kinetics, and comparative responses relative to native IGF-1. Observed molecular effects are dependent on experimental design, concentration, and model system and are used to investigate IGF-1 receptor signalling rather than defined biological or physiological outcomes.

Applications in Research

  • As a molecular tool for studying IGF-1 receptor binding and activation dynamics
  • Investigation of growth factor–mediated intracellular signalling pathways
  • In vitro studies comparing modified and native IGF-1 analogues
  • Use as a reference compound in endocrine and peptide signalling research

Handling, Reconstitution & Stability

  • Weigh under dry conditions; peptide is hygroscopic
  • Reconstitute in sterile water or appropriate buffered aqueous solution depending on assay requirements
  • Avoid vigorous agitation during dissolution
  • Filter sterilize if required (e.g. 0.22 µm) immediately prior to use
  • Aliquot and store reconstituted solutions at –20 °C (or lower) to minimise degradation
  • Avoid repeated freeze–thaw cycles

Specifications Summary

ParameterTypical Value / Range
Purity (HPLC)≥ 99 %
AppearanceWhite to off-white lyophilised powder
Molecular Weight~9117.5 g/mol
Peptide TypeSynthetic IGF-1 analogue
SolubilityWater, buffered aqueous solutions
Storage–20 °C, desiccated, dark
Pack Size1 mg

Precautions & Notes

  • Experimental behaviour of IGF-1 LR3 is influenced by receptor expression, concentration, and exposure duration
  • Modified IGF-1 analogues may exhibit signalling profiles distinct from native IGF-1
  • Buffer composition, pH, and ionic strength may affect peptide stability and assay performance
  • Appropriate controls are recommended to distinguish specific from non-specific effects
  • Intended strictly for laboratory research use; not for human or veterinary application

References

Francis G.L. et al. Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. Journal of Molecular Endocrinology, 1992.
https://pubmed.ncbi.nlm.nih.gov/1378742/

Tomas F.M. et al. Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins is maintained when administered by injection. Journal of Endocrinology, 1996.
https://pubmed.ncbi.nlm.nih.gov/8708565/

Ballard F.J. et al. Does IGF-I ever act through the insulin receptor? Cytokine & Growth Factor Reviews, 1996.
https://pubmed.ncbi.nlm.nih.gov/8899293/

Keywords: IGF-1 LR3, Long Arg³ IGF-1, Insulin-Like Growth Factor Analogue, Synthetic Growth Factor

133 reviews for IGF1-LR3 1mg

  1. John (Verified Purchase)

    Excellent product and works as I expected

  2. STEVE (Verified Purchase)

    Best prices, reliable and great comms

  3. Janis (Verified Purchase)

  4. Pete Robinson (Verified Purchase)

    Great product, decent price, always fast delivery

  5. James Murphy (Verified Purchase)

    Great product which produces Excellent results, highly recommended from a brilliant company.

  6. JARRED

    Outstanding product! Top quality

  7. daniel s.

    Very good quality

  8. Ariel erez (Verified Purchase)

    Just started using this igf and already have seen a huge improvement in my pumps and gains so far I’m super impressed

  9. James H. (Verified Purchase)

  10. Sara garatly

    Expensive

  11. Bruce D.

  12. James Keenan

  13. Vinnie

    Great

  14. Dan

    Great company fast shipping

  15. Steve Walters

    Very good

  16. Connor T.

    Happy so far will be getting more without a doubt!

  17. Alexander

    Mixed well with no residue, can’t comment on effects yet but will definitely repeat buy if effective due to excellent service

  18. STEVEN P.

    Quality peptides and super quick, good comms

  19. Chemz Clear

  20. Kieron Squires

    Fantastic product and service

  21. neil t.

    this was my first time ordering.i understand being nervous ordering from the net but don’t be.great company and super fast delivery.will be ordering again very soon

  22. Anonymous

  23. Nigel Alexander

  24. Jason G.

  25. Aftab Khan

    Expensive and vile needs to be bigger so I can put more water in

  26. Tyler Black

    never got my package

  27. Christopher Prothero

  28. Kirsty

    Fast delivery üöö reply back straight away and very helpful definitely recommend

  29. Paul B.

  30. Paul G.

    100%

  31. Steven

    Quality peptides, with great prices. Shame your 20% discount doesn’t apply if you purchase from Amazon. That be really good if you could enable that

  32. Steven Pierro

    Received the wrong peptides but after reaching out they responded quickly and resolved the issue without delay. Thanks

  33. Rhiannon Cooper

    Excellent value for money.

  34. Richard Baxter

    A total game-changer.

  35. Caroline O.

    CouldnÕt be better.

  36. Sue Facer

    ItÕs a winner.

  37. Elisa

    Absolutely love this.

  38. CHRISTOPHER HORN

    Love it.

  39. Tina Appleton

    Came fast, couldnÕt ask for more.

  40. Deborah

    Arrived so fast, couldnÕt believe it.

  41. Laura P.

    Quick shipping and amazing service.

  42. Iain

    Fast delivery, couldnÕt be happier.

  43. Jeremy

    Got here faster than anticipated.

  44. Helen Braithwaite

    Delivery was incredibly fast!

  45. Lily

    Amazed by the quick delivery.

  46. Joe Madren

    Quick delivery, product is amazing.

  47. Steven Meacham

    Arrived way earlier than I thought.

  48. Siobhan Stewart

    Very happy with my choice.

  49. Sarah Fisher

    CouldnÕt be more pleased.

  50. Jessica A.

    Just awesome.

  51. Wendy Humphrey

    Fantastic product.

  52. Denyse

    Amazing value for money.

  53. Lee S.

    Fantastic performance.

  54. Caron Butler

    Super quick delivery, very happy.

  55. Anonymous

    Fast delivery and works perfectly.

  56. Perry Farman

    Truly excellent.

  57. Simon Underwood

    Great bang for the buck.

  58. Kerry Spence

    Great craftsmanship.

  59. Amie

    Super useful.

  60. Jordyn

    Delivery was super fast and seamless.

  61. Marion Unwin

    Best quality IÕve had.

  62. Fern J.

    ItÕs awesome.

  63. Anonymous

    CanÕt stop using it.

  64. Anonymous

    Beyond satisfied.

  65. Maria

    So glad I bought it.

  66. Hazel

    Love everything about it.

  67. Emma Payne

    Really low-quality product.

  68. Bethany H.

    Disappointed with how long it took to get here.

  69. Viki B.

    Not worth the wait, considering the shipping time.

  70. Helen Robinson

    Shipping was painfully slow.

  71. Abi Askey

    Delivery was much slower than expected.

  72. Anonymous

    IÕve had faster deliveries from other places.

  73. Adam Lane

  74. alaa s.

    Effective and arrived quickly

  75. Mark Buck

    Great product & fast delivery. Thanks

  76. Paul

    Lightning fast delivery (20 hours) and superb products.

  77. Steven Saxton

    As usual no problems at all… ordered.. Delivered within 3 days at the most..
    Quality products

  78. Anonymous

    could be cheaper

  79. Marcin Lechowicz

    Professional service. Fast delivery. Quality stuff

  80. Steve Walters

    Excellent

  81. ANTHONY

    Well packaged and very quick delivery

  82. Patrick Kirwan

  83. Yunis

    Marked results after just 2 weeks of adding to my protocol.

  84. Christine Cartwright

    Well worth the money very gud thanyou

  85. Gareth Paine

  86. Khaled S.

    Purity is insane. Taken after training 60mcg with a carb and protein meal. Woke up next day absolutely pumped and tight. That’s the sign your igf1 is real!! Also packing on muscle. Thanks guys!

  87. Anonymous

  88. Anastacia

    Brilliant product.

  89. Jo

    CanÕt live without it.

  90. Kay Sage

    Brilliant value.

  91. Anonymous

    Truly amazing.

  92. Sheila

    Worth every penny..

  93. Gemma Haworth

    CouldnÕt be more pleased.

  94. Antonia Price

    ItÕs super reliable.

  95. Victoria

    Lives up to the hype.

  96. Becky Punter

    Happy with this purchase.

  97. Simon Underwood

    This is amazing.

  98. Wendy Humphrey

    A real gem.

  99. Ben C.

    Love how it works.

  100. Hollie

    Thrilled with this purchase.

  101. Gemma-Lee

    Beyond my expectations.

  102. Michelle Hiscutt

    Very disappointed in the slow delivery.

  103. Hayley S.

    IÕm not happy with it at all.

  104. Charlotte

    Fast delivery and works great.

  105. Amanda

    It didnÕt meet my expectations.

  106. Mark Andrews

    Extremely happy with my choice.

  107. Louise Williams

    Very well built.

  108. Jessica Pert

    This is my go-to.

  109. chris watts

    Perfect for my needs.

  110. Toni

    Totally worth the price.

  111. SARAH LEADSOM

    Top-notch quality.

  112. Rebecca A.

    Just love how it works.

  113. Emily Walsh

    Works perfectly as expected.

  114. Rhianna D.

    Does what itÕs supposed to.

  115. Stephanie Cooke

    IÕm a fan.

  116. Anonymous

    Very effective.

  117. Ann Elwood

    Great performance.

  118. Julie

    Incredible product.

  119. Ian Bridle

    Love the design.

  120. David

    So glad I found this.

  121. Zoe M.

    Works perfectly as expected.

  122. Katie Hodges

    CouldnÕt ask for more.

  123. Anonymous

    Not impressed with the shipping speed.

  124. Kelly

    Very practical product.

  125. Chloe J.

    CouldnÕt ask for better quality.

  126. Sarah

    So pleased with this.

  127. Timothy

    Super happy with the performance.

  128. Harriet Brannelly

    Love the results.

  129. Mark

    Fast delivery.

  130. Chris H.

    Delivery was fast and hassle-free.

  131. Nic

    IÕm loving it.

  132. Jade Thompson

    Very practical.

  133. Samantha M.

    It stopped working already.

Only logged in customers who have purchased this product may leave a review.