£13.95 with offer

Tesamorelin 5mg

£27.90

Tesamorelin is a synthetic growth hormone–releasing hormone (GHRH) analogue developed for experimental investigation of pituitary receptor–mediated signalling, growth hormone regulation, and downstream endocrine pathways.

  • OP Labs formerly Oxford Peptides
  • Batch tested Purity: ≥ 98.5 % (HPLC, typical)
  • CAS Number: 901758-09-6
  • Molecular Formula: C221H366N72O67S (net peptide); C223H370N72O69S (mono-acetate salt, as supplied)
  • Amino Acid Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (N-terminal trans-3-hexenoyl; C-terminal amide)
  • Molecular Weight: 5135.91 (net peptide); 5195.96 (mono-acetate salt, as supplied)
Volume Pricing
Spend £150+ (20% off)£22.32
Spend £500+ (30% off)£19.53
Spend £1000+ (50% off)£13.95
(350 customer reviews)

In stock

Add to Cart
OP Labs Tesamorelin 5mg GHRH analogue research peptide lyophilized powder in glass vial
Tesamorelin 5mg
£27.90

Free shipping on orders over £20

  • Royal Mail Tracked24
  • Order before 16.00 for same day dispatch
  • Money Back Guarantee
Guaranteed Safe Checkout

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden.

Tesamorelin
Certificate of Analysis (representative)

Representative specimen data. These are typical results for this product. Actual results are batch-specific and are printed on the certificate for the batch number on your vial. Research use only.

Tesamorelin — representative Certificate of Analysis (specimen)
ParameterResult
Product nameTesamorelin
CAS number901758-09-6
Molecular formulaC221H366N72O67S
Molecular weight5135.91 g/mol
AppearanceWhite to off-white powder
Test methodRP-HPLC (C18), UV detection at 220 nm
Purity (HPLC)98.57% (specification ≥ 98.5%)
Mass-spec identityESI-MS (positive): [M+4H]4+ 1285.0, confirming 5135.91 g/mol
Water content3.1% (Karl Fischer, specification ≤ 10.0%)
Analysis dateRepresentative specimen — the analysis date is printed on each batch certificate

Download the specimen certificate (PDF)

  • OP Labs formerly Oxford Peptides.
  • Batch HPLC tested at 98.5%+ purity.
  • Store frozen long term or in fridge when ready to be used.
  • Sold for research purposes only.
  • Contact us for Wholesale Orders.

Search our database for full COA analytics here.

Tesamorelin

Synonyms / Designations: Tesamorelin, TH9507, Growth Hormone–Releasing Hormone (GHRH) analogue
CAS Number: 901758-09-6
Molecular Formula: C223H370N72O69S
Molecular Weight: ~5135.91 g/mol
Peptide Length: 44 amino acids
Peptide Type: Synthetic GHRH analogue
Purity: ≥ 99 % (HPLC, typical)
Appearance: White to off-white lyophilised powder
Pack Size: 5 mg (typical)
Storage: Desiccated, protected from light, stored at –20 °C or below
Solubility: Soluble in water and buffered aqueous solutions

Description & Mechanism

Tesamorelin is a synthetic peptide analogue of human growth hormone–releasing hormone (GHRH 1–44) designed for experimental investigation of hypothalamic–pituitary signalling and growth hormone regulation. Structural modifications enhance stability relative to native GHRH, making Tesamorelin suitable for controlled laboratory research.

In biochemical and cellular research systems, Tesamorelin interacts with the GHRH receptor expressed on pituitary-derived cells, activating intracellular signalling cascades associated with growth hormone synthesis and secretion. Experimental studies examine receptor binding kinetics, cAMP-mediated signalling, and downstream transcriptional responses under defined exposure conditions. Observed effects are dependent on concentration, duration, and experimental model and are used to investigate GHRH receptor signalling rather than defined physiological outcomes.

Applications in Research

  • As a molecular probe for studying GHRH receptor activation and signalling pathways.
  • Investigation of growth hormone regulatory mechanisms in pituitary cell models.
  • In vitro studies examining peptide stability and receptor selectivity.
  • Use as a reference compound in neuroendocrine and peptide signalling research.

Specifications Summary

Purity: (HPLC): ≥ 99 %
Appearance: White to off-white lyophilised powder
Molecular Weight: ~5135.91 g/mol
Peptide Type: Synthetic GHRH analogue
Solubility: Water, buffered aqueous solutions
Storage: –20 °C, desiccated, protected from light
Pack Size: 5 mg

Handling, Reconstitution & Stability

  • Weigh under dry conditions; peptide is hygroscopic.
  • Reconstitute in sterile water or appropriate buffered aqueous solution.
  • Avoid vigorous agitation during dissolution.
  • Filter sterilize if required (e.g. 0.22 µm) prior to use.
  • Aliquot and store reconstituted solutions at –20 °C or lower.
  • Avoid repeated freeze–thaw cycles.

Precautions & Notes

  • Experimental behaviour of Tesamorelin is influenced by receptor expression, peptide concentration, and exposure duration.
  • Buffer composition, pH, and ionic strength may affect peptide stability.
  • Appropriate controls are recommended to distinguish receptor-specific from non-specific effects.
  • Intended strictly for laboratory research use; not for human or veterinary application.

References

Thorner M.O. et al. Growth hormone–releasing hormone and its analogues. Endocrine Reviews, 1997.
https://pubmed.ncbi.nlm.nih.gov/9107404/

Bowers C.Y. Growth hormone–releasing peptides and neuroendocrine regulation. Endocrine Reviews, 2001.
https://pubmed.ncbi.nlm.nih.gov/11159057/

Vance M.L. Growth hormone releasing hormone and pituitary signalling. Journal of Clinical Endocrinology & Metabolism, 2003.
https://pubmed.ncbi.nlm.nih.gov/12629096/

Keywords: Tesamorelin, TH9507, GHRH Analogue, Growth Hormone Regulation, Synthetic Peptide

350 reviews for Tesamorelin 5mg

  1. Michael (Verified Purchase) –

    Amazing stuff for hitting that stubborn fat round the stomach area

  2. Dean Jarmos (Verified Purchase) –

    Amazing

  3. Jeff (Verified Purchase) –

    Good communication

  4. Stuart (Verified Purchase) –

  5. Dougie Stryke (Verified Purchase) –

  6. Ranara (Verified Purchase) –

    Very good product 👍🏼 amazing

  7. Kevin F (Verified Purchase) –

    I have made a number of purchases from Oplabs and have been happy with my experience. My orders have been dealt with quickly, arrived within the allotted time, and the products have always appeared to be very good quality. Overall, I’ve had no issues and would be happy to use them again.

  8. Dean (Verified Purchase) –

    Amazing

  9. Tony D (Verified Purchase) –

    Exactly as ordered.

  10. Chris (Verified Purchase) –

    Delivery time is always spot on. I can’t speak to tangible results yet, I’m slowly working the dose up. In terms of customer service, you are undoubtedly in the right place.

  11. Katrina (Verified Purchase) –

  12. Jonny Teasdale (Verified Purchase) –

  13. Conner Crotchett –

  14. Simon (Verified Purchase) –

  15. Carl (Verified Purchase) –

    Great service, great product that delivers.

  16. Sumaya (Verified Purchase) –

    always reliable, good quality, been ordering since November. good products.

  17. Joanne (Verified Purchase) –

    Easy to order and delivered next day. Will definitely be ordering again.

  18. Klare Osborne (Verified Purchase) –

    Really good. helping maintain the muscle and drop unwanted fat

  19. Trevor Hurley (Verified Purchase) –

    I have used Oplabs over the last 2 years, they are not the cheapest however they are a quality Company, service is excellent, delivery is in a couple of days.

  20. Jon Hughes (Verified Purchase) –

  21. Richard Dolan –

    Early days but seems good quality

  22. Rafal B. (Verified Purchase) –

    Ordered it by mistake , but OP labs accepted return . Superb customer service

  23. Gary L. (Verified Purchase) –

    Great price fast delivery

  24. Mr Mohsin A Nisar (Verified Purchase) –

    amazing

  25. Caroline Salimi (Verified Purchase) –

    Great price, really quick dispatch so no complaints at all, thanks guys!

  26. Scott Westwood (Verified Purchase) –

    Very good service,great price & delivered very quickly

  27. Ronald O. (Verified Purchase) –

    Great product at the best price. Great for targeting visceral fat

  28. Brendan (Verified Purchase) –

    Quick delivery, really good prices quality products and good rep plenty reviews. Tick a lotta boxes.

  29. Daniel (Verified Purchase) –

  30. Peter Fullen –

    Absolutely spot on fantastic service can’t fault at all.

  31. Safaa O. –

    Good quality

  32. Bleu C. –

    Im 5 Days in currently and have noticed a difference in sleep waking up more refreshed more general energy.

  33. Anonymous –

  34. Sara garatly –

  35. Marc –

  36. Anonymous –

    Came quickly very impressed

  37. Lisa C. –

  38. Ciaran D. –

    Better sleep only a few days in, love it

  39. Bruce D. –

  40. Ashley –

    Ordered, and it arrived very quickly. Would definitely recommend!

  41. Les –

    Great service arrived next day great product

  42. Kenneth Dilliway –

  43. Anonymous –

    I’m extremely pleased with the quality, and my progress has been gradual yet impressive. I’m currently stacking it with CJC-1295 No Dac.

  44. Alan Mack –

  45. Stephen Neatby –

  46. alex Bradley –

    Delivered quickly and good communication will definitely using again

  47. Malek –

  48. Anonymous –

    Quite positive results so far.

  49. Stephen Neatby –

  50. David Hall –

    Love the price really good company

  51. David Hall –

    Vey good and quickly delivery

  52. Steve Walters –

    Very good

  53. yuliia c. –

  54. Anonymous –

  55. Paul Russell –

    Excellent product ,very satisfied

  56. Hugh –

    Not used yet

  57. Matthew Dockrill –

    Average price and fast delivery

  58. Dale Donovan –

  59. Jarnail singh Virdee –

  60. Anonymous –

    Quality

  61. Damian –

    Been on it a week and had the best night’s sleep I’ve had in years

  62. James –

    All received thank you

  63. Mark D. –

    I was really impressed how this reduces belly fat so quickly. Definitely reordering!

  64. Lauren –

    Low prices and quick delivery

  65. Stephen Neatby –

  66. Anonymous –

  67. Tom –

    So far so good

  68. David Moir –

    This makes me sweat a bit but too early to tell if its taken affect as ita only been one week but do feel like its starting to do its stuff.

  69. Anonymous –

  70. Chris S. –

    Great service great price

  71. Richard Deary –

    Quick discrete postage. Good value. I have another order placed and will continue to use this company for all my peptidesüòÅ

  72. Kevin S. –

    Next day delivery, perfect

  73. Anonymous –

  74. Anonymous –

  75. Anonymous –

  76. William –

    Brilliant product doing what its says it can.

  77. David G. –

    I’m very happy with this service, extremely quick delivery and reasonable prices, to me reliability is everything and this company i can definitely rely on, so all good from me!

  78. Parmvir –

  79. Dylan C. –

  80. Robert Rogers –

  81. Mark France –

    Great service

  82. Vincenzo S. –

    Great quality, fast shipping, will order again!

  83. Wesley Hurst –

    Very good stuff

  84. Nathan –

    Great product this is

  85. Anonymous –

    Super quick dispatch and delivery

  86. Karen W. –

    Totally worth the price.

  87. Sue Facer –

    Does what itÕs supposed to.

  88. Lorraine Mckeown –

    Super efficient.

  89. Allison Winter –

    Super speedy delivery, highly recommend.

  90. Ally –

    Delivery was fast and hassle-free.

  91. Anonymous –

    CanÕt live without it now.

  92. Tracy –

    Love this purchase.

  93. Jennifer Markham –

    Just love how it works.

  94. Rachel D. –

    Love this purchase.

  95. Stephen –

    CouldnÕt ask for a better product.

  96. Lisa Kaye –

    CouldnÕt ask for more.

  97. Philippa Burnet –

    Very effective.

  98. Ami –

    Excellent craftsmanship.

  99. Holly B. –

    I use it all the time.

  100. Tony Dove –

    Very versatile.

  101. Emmalene White –

    A total game-changer.

  102. Holly Barratt –

    Super efficient.

  103. Sarah –

    Super functional.

  104. Sarah G. –

    Love the features.

  105. Mrs J. –

    It works beautifully.

  106. Emma C. –

    IÕm beyond thrilled.

  107. Sarah Ayres-Townshend –

    Love the results.

  108. Wiktoria Pipczynska –

    This is amazing.

  109. Anna Brigham –

    Beyond my expectations.

  110. Byron De Winter –

    Amazing functionality.

  111. Sara M. –

    CanÕt live without it.

  112. Susan –

    So useful.

  113. Ashley Berrisford –

    Love it.

  114. Anonymous –

    Came quickly, very happy with it.

  115. Liz Ferguson –

    Delivery was fast and the product is great.

  116. Amy L. –

    Delivery was super quick.

  117. Anamaria V. –

    Product came fast, love the quality.

  118. Katrina –

    Fast delivery and super happy with it.

  119. Stacey G. –

    Arrived quickly, love the quality.

  120. Nick Morris –

    Came fast, works perfectly.

  121. Ashley Taylor –

    Product arrived quickly, just as described.

  122. Caroline –

    Excellent product and fast delivery.

  123. Caroline –

    Delivery was super fast and smooth.

  124. John Beaton –

    Amazed by the quick delivery.

  125. Anonymous –

    Fast delivery, very impressed.

  126. Gabriella –

    IÕm amazed by how well this works.

  127. Susie –

    Great product, great price.

  128. Vikki M. –

    IÕm loving it.

  129. Jade Blundell –

    Great addition to my collection.

  130. Ida M. –

    Excellent value for money.

  131. Wendy C. –

    Works flawlessly.

  132. Abi –

    A real gem.

  133. Mel M. –

    Great design and quality.

  134. Beata Mielko –

    IÕm a fan.

  135. Natalie Green-Wood –

    Quality is amazing.

  136. Helen B. –

    Totally satisfied.

  137. Claire –

    Great value.

  138. Linda Barnes –

    Very useful and practical.

  139. Luisana Toner –

    Extremely satisfied.

  140. Owen Calaby –

    A total game-changer.

  141. Emma Richardson –

    Very functional.

  142. Fatimah Z. –

    Worth the investment.

  143. John Spicer –

    Very reliable.

  144. stephanie –

    So useful.

  145. Bree Terry –

    The best product IÕve ever used.

  146. Callum F. –

    This is really great quality.

  147. Helen –

    Amazing craftsmanship.

  148. Natasha –

    This is top-tier quality.

  149. Gillian –

    Super happy with how it works.

  150. Kay Hunt –

    IÕm totally impressed.

  151. Joanna Butler –

    IÕm super satisfied.

  152. Chloe –

    This product rocks.

  153. William –

    Great addition to my collection.

  154. Paula P. –

    Happy with this purchase.

  155. Claire W. –

    CanÕt stop using it.

  156. Rachel Holliday –

    Very functional.

  157. Carol McConnachie –

    Best product ever.

  158. Gemma –

    Totally recommend it.

  159. Callum –

    Highly satisfied.

  160. Anonymous –

    Worth the investment.

  161. Alice B. –

    Fast delivery, just what I needed.

  162. Stefanie Camborne-Paynter –

    Received it so fast, thank you!

  163. Saara Hanso –

    Got it fast, love it.

  164. Lauren –

    Very impressed with the results.

  165. Mark Jackson –

    CanÕt live without it now.

  166. Greig –

    Super functional.

  167. Anonymous –

    IÕm thrilled with the results.

  168. Stacey W. –

    ItÕs really top-notch.

  169. Elizabeth –

    Absolutely fantastic.

  170. Charlene McNabb –

    Best in the market.

  171. Laura –

    Outstanding quality.

  172. Amy A. –

    This product rocks.

  173. Saara Hanso –

    Just amazing.

  174. Daniel –

    Excellent performance.

  175. Leo McIntosh –

    Lives up to the hype.

  176. Beth –

    IÕm obsessed.

  177. Sarah Lowing –

    Very reliable.

  178. Wayne Cross –

    Love the design.

  179. Laura Ramsey –

    Exceeded my expectations.

  180. Susan Gardler –

    So glad I found this.

  181. Eve R. –

    Super happy with how it works.

  182. Jack Richards –

    Great product, would buy again.

  183. Sarah L. –

    Highly reliable.

  184. Morgan –

    Very happy with my choice.

  185. Anonymous –

    The best IÕve seen.

  186. James –

    ItÕs perfect for me.

  187. Laura B. –

    ItÕs super reliable.

  188. luke williams –

    Very impressed with this.

  189. Brittany –

    Best purchase ever.

  190. Nicola Weaver –

    Five stars.

  191. Charlotte –

    Fast delivery, fantastic product.

  192. Annie –

    Fantastic product quality.

  193. Lesley R. –

    Very versatile.

  194. Kerry Spence –

    Completely satisfied.

  195. Sue L. –

    A great product.

  196. Marion Unwin –

    Works perfectly every time.

  197. Victoria –

    IÕm very impressed.

  198. Janey –

    Delivers as promised.

  199. Anonymous –

    Speedy shipping, exactly what I needed.

  200. Emma Payne –

    So convenient.

  201. Nicola Paling –

    Love using this.

  202. Warren G. –

    Does the job perfectly.

  203. Elise –

    CouldnÕt be happier.

  204. Gemma V. –

    High-quality product.

  205. Imogen W. –

    CanÕt recommend this enough.

  206. Teresa Oconnell –

    Absolutely love the quality.

  207. Will Williamson –

    Extremely happy with my choice.

  208. Hannah Horan –

    This is so well made.

  209. Anonymous –

    Arrived earlier than I thought.

  210. Samuel H. –

    IÕm so impressed.

  211. Ethan Brown –

    Does the job perfectly.

  212. Carole –

    IÕm beyond thrilled.

  213. Jocelyn –

    Totally disappointed in the quality.

  214. Bethany H. –

    Way too slow, wonÕt order again.

  215. Anonymous –

    I thought it would never show up.

  216. Tina Thomson –

    Very slow shipping, not happy at all.

  217. Anonymous –

    Delivery speed was awful.

  218. Ann H. –

    Wasn’t happy with how long it took.

  219. Lucy –

    DidnÕt last as long as it should.

  220. Jesse Dodoo –

    DoesnÕt work as advertised.

  221. Kim –

    Definitely wouldnÕt recommend.

  222. Matthew C. –

    Frustrated with how slow the shipping was.

  223. Margot C. –

    Delivery was much slower than expected.

  224. Anonymous –

    DoesnÕt live up to the hype.

  225. Carl –

  226. Wesley Hurst –

    Very quick and quality product

  227. paul b. –

    Thus is next level. This is a fat burner at its best

  228. Steven Jones –

  229. Karl Jaundrill –

  230. MARK PATTERSON –

  231. Chee Seong Foo –

    Just wished it was cheaper. And the 20% discount not just for purchases above 100 pounds.

  232. stephen –

    Great value for money

  233. George Bowe –

  234. Andreas Zenonos –

  235. Matthew Dockrill –

    Speedy service very happy

  236. david john THOMAS –

  237. Stephen Neatby –

    Always excellent service

  238. George C. –

    OP was recommended to me by a friend. After an issue with shipping (RM) I contacted OP customer services and Bella was great. She was straight on the case and got the issue resolved. Definitely continue to source my peptides from OP.

  239. Steve Walters –

    Excellent

  240. Anonymous –

    Great communication, product arrived promptly, good quality.

  241. Anonymous –

  242. Tarik –

    Great product, quick delivery

  243. Kevin C. –

  244. Russell H. –

    Great product

  245. Samara –

    Great service, received quickly with clear communication throughout

  246. Mark France –

    Fantastic product

  247. Patrick –

    Great service

  248. Debbie –

    Love the design.

  249. Anonymous –

    It works so well.

  250. Peter Norris –

    Fantastic performance.

  251. Katie C. –

    IÕm totally impressed.

  252. Gina F. –

    Very durable and reliable.

  253. Sarah –

    CouldnÕt ask for better quality.

  254. Anonymous –

    Very effective.

  255. Anonymous –

    Arrived quicker than expected.

  256. Roisin Lloyd –

    Totally satisfied with this.

  257. Jane Leach –

    This is so well made.

  258. Emma –

    This is awesome.

  259. Verified Buyer –

    I wonÕt be buying this again.

  260. Samuel B. –

    Exactly as described.

  261. Verified Buyer –

    CanÕt go wrong with this.

  262. Barb Clifford –

    Very impressed with this.

  263. Richard H. –

    Well worth it.

  264. Laura R. –

    I use it all the time.

  265. Mandi M. –

    Well made.

  266. Felicity –

    CanÕt recommend this enough.

  267. Anonymous –

    So glad I bought this.

  268. Jennifer Hughes –

    Great investment.

  269. Michael H. –

    Got it so fast, very satisfied.

  270. Caroline –

    Delivered much faster than expected.

  271. Georgia Danes –

    IÕve seen better for less.

  272. Laura –

    CouldnÕt be more satisfied.

  273. Sue Bennett –

    Excellent craftsmanship.

  274. Joanne M. –

    Love this item.

  275. Fiona Kester –

    Brilliant value.

  276. Alexander P. –

    This is awesome.

  277. Gemma –

    It took forever to get here.

  278. Nicola B. –

    Very dependable product.

  279. Anonymous –

    Works perfectly every time.

  280. Nicola M. –

    Worth the price.

  281. Thomas Aurelius –

    IÕm so impressed.

  282. SAKSHI A. –

    It works beautifully.

  283. Sara Lamont –

    Excellent quality.

  284. Alice Thorne –

    IÕm not happy with it at all.

  285. Anonymous –

    Got it fast, highly satisfied.

  286. kai –

    Delivery was quicker than anticipated.

  287. Jenna Kaye –

    Fast delivery, product is perfect.

  288. Nathalie Smith –

    Super fast delivery, no issues at all.

  289. Richard Mawer –

    Quick shipping and amazing service.

  290. Lorna –

    Fast delivery and excellent product.

  291. Dulcie R. –

    Got it delivered in record time.

  292. Anonymous –

    Delivery was super fast and smooth.

  293. Ben C. –

    Speedy delivery, great product.

  294. Matthew –

    Arrived quicker than expected.

  295. Trishna Tripuraneni –

    Fast delivery, fantastic product.

  296. Emma Mullins –

    Fast delivery and super happy with it.

  297. Alice –

    Came fast, couldnÕt ask for more.

  298. Heidi Banks –

    Fast delivery, product is perfect.

  299. Megan –

    IÕm a fan.

  300. Anna –

    Worth the investment.

  301. Hayley –

    Very pleased with this.

  302. Robyn –

    Top-notch quality.

  303. Amanda –

    Totally love it.

  304. Lewis Evans –

    Incredible product.

  305. Rachel E. –

    Overhyped and underdelivers.

  306. George Varnes –

    Worth every penny.

  307. Hannah –

    Love it.

  308. Gillian –

    Very impressed with the results.

  309. Anna –

    It works so well.

  310. Marine –

    Shipping should not take this long in 2024.

  311. isabel –

    Excellent quality product.

  312. Bethany Cowan –

    So glad I found this.

  313. Mark Andrews –

    Just perfect for me.

  314. Sarah D. –

    ItÕs everything I wanted.

  315. Phoenix –

    Super happy I found this.

  316. Monique –

    Best quality IÕve had.

  317. Eamon B. –

    Fantastic product quality.

  318. Louise B. –

    Extremely happy with this.

  319. Anonymous –

    IÕm so impressed.

  320. Marion –

    So pleased with this.

  321. Nicol MacKinnon –

    Love this purchase.

  322. Sue L. –

    Very high-quality.

  323. Jessica Pert –

    Amazing quality.

  324. Holly –

    IÕm super satisfied.

  325. Alexandra S. –

    Very dependable.

  326. Rachael Carragher –

    Excellent quality.

  327. Vicky –

    Very happy with my choice.

  328. michelle schmidt –

    Perfect for what I needed.

  329. Ben –

    IÕm very pleased.

  330. Anonymous –

    CouldnÕt be more pleased.

  331. Anonymous –

    CanÕt recommend enough.

  332. Heidi Banks –

    I use it all the time.

  333. Sophie –

    Great bang for the buck.

  334. Matthew M. –

    ItÕs super reliable.

  335. Ayrton –

    IÕm so happy I bought this.

  336. Anonymous –

    Great addition to my collection.

  337. Alexander P. –

    Very effective.

  338. Anonymous –

    Quality is amazing.

  339. Shelley Groves –

    Best value ever.

  340. Cath S. –

    IÕm impressed.

  341. Megan Guinan –

    Why did this take forever to arrive?

  342. Mx P M Kitcher –

    Fantastic performance.

  343. Stef B. –

    Very durable.

  344. Maxine –

    Beyond my expectations.

  345. Anonymous –

    CouldnÕt ask for more.

  346. Cerrinda M. –

    Does exactly what it says.

  347. Molly L. –

    ItÕs a lifesaver.

  348. Rhanna –

    Love using this.

  349. Tory G. –

    Very disappointed with the performance.

  350. Catherine T. –

    A must-have.

Only logged in customers who have purchased this product may leave a review.