£9.07 with offer

Sermorelin 2mg

£12.95

Sermorelin is a peptide analogue of growth hormone–releasing hormone (GHRH 1–29), used in experimental research to investigate hypothalamic–pituitary signalling, growth hormone secretion dynamics, and receptor-mediated neuroendocrine regulation.

  • OP Labs formerly Oxford Peptides
  • Batch tested Purity: ≥ 99 % (HPLC, typical)
  • CAS Number: 86168-78-7
  • Peptide Type: Synthetic GHRH (1–29) analogue peptide
  • Amino Acid Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (GRF 1-29, C-terminal amide)
Volume Pricing
Spend £150+ (20% off)£10.36
Spend £500+ (30% off)£9.07

Spending over £1000? Email us your order and we will custom price.

(18 customer reviews)

In stock

Add to Cart
OP Labs Sermorelin 2mg research peptide in glass vial
Sermorelin 2mg
£12.95

Free shipping on orders over £20

  • Royal Mail Tracked24
  • Order before 16.00 for same day dispatch
  • Money Back Guarantee
Guaranteed Safe Checkout

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden.

Sermorelin
Certificate of Analysis (representative)

Representative specimen data. These are typical results for this product. Actual results are batch-specific and are printed on the certificate for the batch number on your vial. Research use only.

Sermorelin — representative Certificate of Analysis (specimen)
ParameterResult
Product nameSermorelin
CAS number86168-78-7
Molecular formulaC149H246N44O42S
Molecular weight3357.96 g/mol
AppearanceWhite to off-white powder
Test methodRP-HPLC (C18), UV detection at 220 nm
Purity (HPLC)98.85% (specification ≥ 98.5%)
Mass-spec identityESI-MS (positive): [M+2H]2+ 1680.0, confirming 3357.96 g/mol
Water content5.0% (Karl Fischer, specification ≤ 10.0%)
Analysis dateRepresentative specimen — the analysis date is printed on each batch certificate

Download the specimen certificate (PDF)

  • OP Labs formerly Oxford Peptides
  • HPLC tested at ≥99% purity
  • Store frozen long term or in fridge when ready to be used
  • Sold for research purposes only
  • Contact us for Wholesale Orders

Search our database for full COA analytics here.

Sermorelin

Synonyms / Designations: Sermorelin, Sermorelin Acetate, Growth Hormone–Releasing Hormone (GHRH 1–29) analogue
CAS Number: 86168-78-7
Molecular Formula: C149H246N44O42S
Molecular Weight:3357.96 g/mol
Peptide Classification: Synthetic peptide; truncated analogue of human growth hormone–releasing hormone (GHRH)
Purity: ≥ 99 % (HPLC, typical)
Appearance: White to off-white lyophilised powder
Pack Size: 2 mg
Storage: Desiccated, protected from light, stored at –20 Solubility: Soluble in sterile water and buffered aqueous solutions

Description & Mechanism

Sermorelin is a synthetic peptide corresponding to the first 29 amino acids of endogenous human growth hormone–releasing hormone (GHRH). It represents the minimal biologically active fragment of GHRH and is used in research settings to investigate hypothalamic–pituitary signalling pathways involved in growth hormone regulation.

In biochemical and cellular research systems, Sermorelin interacts with the growth hormone–releasing hormone receptor (GHRH-R) expressed on pituitary somatotroph cells, initiating intracellular signalling cascades that regulate growth hormone synthesis and release. Experimental studies typically focus on receptor binding, signal transduction mechanisms, and comparative analysis relative to full-length GHRH. Observed effects are dependent on experimental design, concentration, and model system.

Applications in Research

• Investigation of GHRH receptor binding and signalling pathways
• Study of hypothalamic–pituitary axis regulation
• In vitro comparison of truncated versus full-length GHRH peptides
• Use as a reference compound in neuroendocrine and peptide signalling research

Handling, Reconstitution & Stability

• Weigh under dry conditions; peptide is hygroscopic
• Reconstitute in sterile water or appropriate buffered aqueous solution
• Avoid vigorous agitation during dissolution
• Filter sterilize if required (0.22 µm) prior to use
• Aliquot and store reconstituted solutions at –20 °C or below
• Avoid repeated freeze–thaw cycles

Specifications Summary

Purity: ≥ 99 %
Appearance: White to off-white lyophilised powder
Peptide Type: Synthetic GHRH analogue
Molecular Weight: 3357.96 g/mol
Solubility: Water, buffered aqueous solutions
Storage: –20 °C, desiccated, protected from light
Pack Size: 2 mg

Precautions & Notes

• Experimental behaviour of Sermorelin is influenced by receptor expression, concentration, and exposure duration
• Peptide stability may be affected by pH, enzymatic activity, and buffer composition
• Appropriate controls are recommended to distinguish receptor-specific from non-specific effects
• Intended strictly for laboratory research use; not for human or veterinary application

References

Frohman L.A. et al. Growth hormone–releasing hormone: structure, function, and regulation. Endocrine Reviews.
https://pubmed.ncbi.nlm.nih.gov/2549426/

Thorner M.O. et al. Mechanisms of growth hormone secretion. Journal of Clinical Endocrinology & Metabolism.
https://pubmed.ncbi.nlm.nih.gov/3297083/

Mayo K.E. et al. Growth hormone–releasing hormone receptor biology. Endocrine Reviews.
https://pubmed.ncbi.nlm.nih.gov/9467534/

Frohman L.A., Downs T.R., Clarke I.J. Growth hormone–releasing hormone: molecular biology, physiology, and clinical relevance. Endocrine Reviews.
https://pubmed.ncbi.nlm.nih.gov/2168608/

Bowers C.Y., Momany F.A., Reynolds G.A. On the in vitro and in vivo activity of growth hormone–releasing hormone fragments. Endocrinology.
https://pubmed.ncbi.nlm.nih.gov/3930061/

Keywords: Sermorelin, GHRH 1–29, Growth Hormone–Releasing Hormone, Synthetic Peptide, Neuroendocrine Signalling

18 reviews for Sermorelin 2mg

  1. Jacqui (Verified Purchase)

    Fantastic

  2. Robert Patterson (Verified Purchase)

    All the best peptides available with immediate delivery

  3. Conner Crotchett

  4. Robert Patterson (Verified Purchase)

    All the peptides you need at at great price

  5. Julie Armytage (Verified Purchase)

  6. Alan (Verified Purchase)

    My go to Company for Sermorelin because of their easy order process and reliable quality

  7. John 60 yrs (Verified Purchase)

    Does exactly what you want it to do. I have been researching over a year and had nothing but good results with OP purchases .

  8. Nigel L. (Verified Purchase)

    Same good quality fast delivery

  9. Jason C. (Verified Purchase)

  10. Anonymous

    Amazing.

  11. Bruce D.

  12. Jarnail singh

    I’ve always purchased from Oxford peptides and this product is spot on

  13. Bradlaugh Culverwell

  14. Sebastian Schreiber

  15. Jarnail singh

  16. Steve W.

    Excellent

  17. Jamie M.

    Brilliant quality

  18. Jarnail Singh

Only logged in customers who have purchased this product may leave a review.