£17.48 with offer

IGF1-LR3 1mg

£34.95

IGF-1 LR3 is a specialised research peptide developed for advanced scientific investigation of insulin-like growth factor receptor (IGF-1R) signalling, growth factor–mediated pathways, and downstream intracellular regulatory mechanisms.

OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 99 % (HPLC, typical)
CAS Number: 946870-92-4
Molecular Formula: C400H625N111O115S9

Volume Pricing
Spend £150+ (20% off)£27.96
Spend £500+ (30% off)£24.47
Spend £1000+ (50% off)£17.48
  • Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Long-R3 IGF-1, 83 aa; 3 intramolecular disulfide bonds)
(135 customer reviews)

In stock

Add to Cart
OP Labs IGF-1 LR3 1mg research peptide lyophilized powder in glass vial
IGF1-LR3 1mg
£34.95

Free shipping on orders over £20

  • Royal Mail Tracked24
  • Order before 16.00 for same day dispatch
  • Money Back Guarantee
Guaranteed Safe Checkout

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden.

IGF-1 LR3 (Long R3 IGF-1)
Certificate of Analysis (representative)

Representative specimen data. These are typical results for this product. Actual results are batch-specific and are printed on the certificate for the batch number on your vial. Research use only.

IGF-1 LR3 (Long R3 IGF-1) — representative Certificate of Analysis (specimen)
ParameterResult
Product nameIGF-1 LR3 (Long R3 IGF-1)
CAS number946870-92-4
Molecular formulaC400H625N111O115S9
Molecular weight9117.5 g/mol
AppearanceWhite to off-white powder
Test methodRP-HPLC (C18), UV detection at 220 nm
Purity (HPLC)98.56% (specification ≥ 98.5%)
Mass-spec identityESI-MS (positive): [M+7H]7+ 1303.5, confirming 9117.5 g/mol
Water content3.8% (Karl Fischer, specification ≤ 10.0%)
Analysis dateRepresentative specimen — the analysis date is printed on each batch certificate

Download the specimen certificate (PDF)

  • OP Labs formerly Oxford Peptides
  • Batch HPLC tested at 98.5%+ purity
  • Store frozen long term or in fridge when ready to be used
  • Sold for research purposes only
  • Contact us for Wholesale Orders

Search our database for full COA analytics here.

IGF-1 LR3

Synonyms / Designations: IGF-1 LR3, Long Arg³ IGF-1, Insulin-Like Growth Factor-1 LR3, Recombinant IGF-1 analogue
CAS Number: 946870-92-4
Molecular Formula: C400H625N111O115S9
Molecular Weight: 9117.5 g/mol
Peptide Classification: Synthetic analogue of insulin-like growth factor-1 (IGF-1)
Purity: ≥ 99 % (HPLC, typical)
Appearance: White to off-white lyophilised powder
Pack Size: 1 mg (total)
Storage: Desiccated, protected from light, stored at –20 °C
Solubility: Soluble in sterile water and buffered aqueous solutions

Description & Mechanism

IGF-1 LR3 is a synthetic analogue of human insulin-like growth factor-1 (IGF-1) incorporating an arginine substitution at position 3 and an extended N-terminal sequence. These structural modifications reduce affinity for endogenous IGF binding proteins, resulting in altered stability and interaction characteristics in experimental systems compared to native IGF-1.

In biochemical and cellular research models, IGF-1 LR3 interacts with the IGF-1 receptor (IGF-1R), initiating intracellular signalling cascades associated with growth factor–mediated pathways. Research studies commonly examine receptor binding behaviour, downstream signalling kinetics, and comparative responses relative to native IGF-1. Observed molecular effects are dependent on experimental design, concentration, and model system and are used to investigate IGF-1 receptor signalling rather than defined biological or physiological outcomes.

Applications in Research

  • As a molecular tool for studying IGF-1 receptor binding and activation dynamics
  • Investigation of growth factor–mediated intracellular signalling pathways
  • In vitro studies comparing modified and native IGF-1 analogues
  • Use as a reference compound in endocrine and peptide signalling research

Handling, Reconstitution & Stability

  • Weigh under dry conditions; peptide is hygroscopic
  • Reconstitute in sterile water or appropriate buffered aqueous solution depending on assay requirements
  • Avoid vigorous agitation during dissolution
  • Filter sterilize if required (e.g. 0.22 µm) immediately prior to use
  • Aliquot and store reconstituted solutions at –20 °C (or lower) to minimise degradation
  • Avoid repeated freeze–thaw cycles

Specifications Summary

ParameterTypical Value / Range
Purity (HPLC)≥ 99 %
AppearanceWhite to off-white lyophilised powder
Molecular Weight~9117.5 g/mol
Peptide TypeSynthetic IGF-1 analogue
SolubilityWater, buffered aqueous solutions
Storage–20 °C, desiccated, dark
Pack Size1 mg

Precautions & Notes

  • Experimental behaviour of IGF-1 LR3 is influenced by receptor expression, concentration, and exposure duration
  • Modified IGF-1 analogues may exhibit signalling profiles distinct from native IGF-1
  • Buffer composition, pH, and ionic strength may affect peptide stability and assay performance
  • Appropriate controls are recommended to distinguish specific from non-specific effects
  • Intended strictly for laboratory research use; not for human or veterinary application

References

Francis G.L. et al. Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. Journal of Molecular Endocrinology, 1992.
https://pubmed.ncbi.nlm.nih.gov/1378742/

Tomas F.M. et al. Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins is maintained when administered by injection. Journal of Endocrinology, 1996.
https://pubmed.ncbi.nlm.nih.gov/8708565/

Ballard F.J. et al. Does IGF-I ever act through the insulin receptor? Cytokine & Growth Factor Reviews, 1996.
https://pubmed.ncbi.nlm.nih.gov/8899293/

Keywords: IGF-1 LR3, Long Arg³ IGF-1, Insulin-Like Growth Factor Analogue, Synthetic Growth Factor

135 reviews for IGF1-LR3 1mg

  1. Paul stewart (Verified Purchase) –

    This stuff is absolutely insane well worth it and good value if you buy multiple

  2. Paul glad (Verified Purchase) –

    Made up with op labs igf1 lr3 100% 💪💪💪💪💪

  3. John (Verified Purchase) –

    Excellent product and works as I expected

  4. STEVE (Verified Purchase) –

    Best prices, reliable and great comms

  5. Janis (Verified Purchase) –

  6. Pete Robinson (Verified Purchase) –

    Great product, decent price, always fast delivery

  7. James Murphy (Verified Purchase) –

    Great product which produces Excellent results, highly recommended from a brilliant company.

  8. JARRED –

    Outstanding product! Top quality

  9. daniel s. –

    Very good quality

  10. Ariel erez (Verified Purchase) –

    Just started using this igf and already have seen a huge improvement in my pumps and gains so far I’m super impressed

  11. James H. (Verified Purchase) –

  12. Sara garatly –

    Expensive

  13. Bruce D. –

  14. James Keenan –

  15. Vinnie –

    Great

  16. Dan –

    Great company fast shipping

  17. Steve Walters –

    Very good

  18. Connor T. –

    Happy so far will be getting more without a doubt!

  19. Alexander –

    Mixed well with no residue, can’t comment on effects yet but will definitely repeat buy if effective due to excellent service

  20. STEVEN P. –

    Quality peptides and super quick, good comms

  21. Chemz Clear –

  22. Kieron Squires –

    Fantastic product and service

  23. neil t. –

    this was my first time ordering.i understand being nervous ordering from the net but don’t be.great company and super fast delivery.will be ordering again very soon

  24. Anonymous –

  25. Nigel Alexander –

  26. Jason G. –

  27. Aftab Khan –

    Expensive and vile needs to be bigger so I can put more water in

  28. Tyler Black –

    never got my package

  29. Christopher Prothero –

  30. Kirsty –

    Fast delivery üöö reply back straight away and very helpful definitely recommend

  31. Paul B. –

  32. Paul G. –

    100%

  33. Steven –

    Quality peptides, with great prices. Shame your 20% discount doesn’t apply if you purchase from Amazon. That be really good if you could enable that

  34. Steven Pierro –

    Received the wrong peptides but after reaching out they responded quickly and resolved the issue without delay. Thanks

  35. Rhiannon Cooper –

    Excellent value for money.

  36. Richard Baxter –

    A total game-changer.

  37. Caroline O. –

    CouldnÕt be better.

  38. Sue Facer –

    ItÕs a winner.

  39. Elisa –

    Absolutely love this.

  40. CHRISTOPHER HORN –

    Love it.

  41. Tina Appleton –

    Came fast, couldnÕt ask for more.

  42. Deborah –

    Arrived so fast, couldnÕt believe it.

  43. Laura P. –

    Quick shipping and amazing service.

  44. Iain –

    Fast delivery, couldnÕt be happier.

  45. Jeremy –

    Got here faster than anticipated.

  46. Helen Braithwaite –

    Delivery was incredibly fast!

  47. Lily –

    Amazed by the quick delivery.

  48. Joe Madren –

    Quick delivery, product is amazing.

  49. Steven Meacham –

    Arrived way earlier than I thought.

  50. Siobhan Stewart –

    Very happy with my choice.

  51. Sarah Fisher –

    CouldnÕt be more pleased.

  52. Jessica A. –

    Just awesome.

  53. Wendy Humphrey –

    Fantastic product.

  54. Denyse –

    Amazing value for money.

  55. Lee S. –

    Fantastic performance.

  56. Caron Butler –

    Super quick delivery, very happy.

  57. Anonymous –

    Fast delivery and works perfectly.

  58. Perry Farman –

    Truly excellent.

  59. Simon Underwood –

    Great bang for the buck.

  60. Kerry Spence –

    Great craftsmanship.

  61. Amie –

    Super useful.

  62. Jordyn –

    Delivery was super fast and seamless.

  63. Marion Unwin –

    Best quality IÕve had.

  64. Fern J. –

    ItÕs awesome.

  65. Anonymous –

    CanÕt stop using it.

  66. Anonymous –

    Beyond satisfied.

  67. Maria –

    So glad I bought it.

  68. Hazel –

    Love everything about it.

  69. Emma Payne –

    Really low-quality product.

  70. Bethany H. –

    Disappointed with how long it took to get here.

  71. Viki B. –

    Not worth the wait, considering the shipping time.

  72. Helen Robinson –

    Shipping was painfully slow.

  73. Abi Askey –

    Delivery was much slower than expected.

  74. Anonymous –

    IÕve had faster deliveries from other places.

  75. Adam Lane –

  76. alaa s. –

    Effective and arrived quickly

  77. Mark Buck –

    Great product & fast delivery. Thanks

  78. Paul –

    Lightning fast delivery (20 hours) and superb products.

  79. Steven Saxton –

    As usual no problems at all… ordered.. Delivered within 3 days at the most..
    Quality products

  80. Anonymous –

    could be cheaper

  81. Marcin Lechowicz –

    Professional service. Fast delivery. Quality stuff

  82. Steve Walters –

    Excellent

  83. ANTHONY –

    Well packaged and very quick delivery

  84. Patrick Kirwan –

  85. Yunis –

    Marked results after just 2 weeks of adding to my protocol.

  86. Christine Cartwright –

    Well worth the money very gud thanyou

  87. Gareth Paine –

  88. Khaled S. –

    Purity is insane. Taken after training 60mcg with a carb and protein meal. Woke up next day absolutely pumped and tight. That’s the sign your igf1 is real!! Also packing on muscle. Thanks guys!

  89. Anonymous –

  90. Anastacia –

    Brilliant product.

  91. Jo –

    CanÕt live without it.

  92. Kay Sage –

    Brilliant value.

  93. Anonymous –

    Truly amazing.

  94. Sheila –

    Worth every penny..

  95. Gemma Haworth –

    CouldnÕt be more pleased.

  96. Antonia Price –

    ItÕs super reliable.

  97. Victoria –

    Lives up to the hype.

  98. Becky Punter –

    Happy with this purchase.

  99. Simon Underwood –

    This is amazing.

  100. Wendy Humphrey –

    A real gem.

  101. Ben C. –

    Love how it works.

  102. Hollie –

    Thrilled with this purchase.

  103. Gemma-Lee –

    Beyond my expectations.

  104. Michelle Hiscutt –

    Very disappointed in the slow delivery.

  105. Hayley S. –

    IÕm not happy with it at all.

  106. Charlotte –

    Fast delivery and works great.

  107. Amanda –

    It didnÕt meet my expectations.

  108. Mark Andrews –

    Extremely happy with my choice.

  109. Louise Williams –

    Very well built.

  110. Jessica Pert –

    This is my go-to.

  111. chris watts –

    Perfect for my needs.

  112. Toni –

    Totally worth the price.

  113. SARAH LEADSOM –

    Top-notch quality.

  114. Rebecca A. –

    Just love how it works.

  115. Emily Walsh –

    Works perfectly as expected.

  116. Rhianna D. –

    Does what itÕs supposed to.

  117. Stephanie Cooke –

    IÕm a fan.

  118. Anonymous –

    Very effective.

  119. Ann Elwood –

    Great performance.

  120. Julie –

    Incredible product.

  121. Ian Bridle –

    Love the design.

  122. David –

    So glad I found this.

  123. Zoe M. –

    Works perfectly as expected.

  124. Katie Hodges –

    CouldnÕt ask for more.

  125. Anonymous –

    Not impressed with the shipping speed.

  126. Kelly –

    Very practical product.

  127. Chloe J. –

    CouldnÕt ask for better quality.

  128. Sarah –

    So pleased with this.

  129. Timothy –

    Super happy with the performance.

  130. Harriet Brannelly –

    Love the results.

  131. Mark –

    Fast delivery.

  132. Chris H. –

    Delivery was fast and hassle-free.

  133. Nic –

    IÕm loving it.

  134. Jade Thompson –

    Very practical.

  135. Samantha M. –

    It stopped working already.

Only logged in customers who have purchased this product may leave a review.