£14.98 with offer

LL37 5mg

£29.95

LL-37 is a synthetic cathelicidin-derived antimicrobial peptide used as a research tool to investigate host-defence peptide signalling and innate immune mechanisms in experimental systems.

  • OP Labs formerly Oxford Peptides
  • Batch tested Purity: ≥ 98.5 % (HPLC, typical)
  • CAS Number: 154947-66-7
  • Molecular Formula: C205H340N60O53
  • Amino Acid Sequence: [LL-37, 37 aa] (37-residue cathelicidin peptide)
Volume Pricing
Spend £150+ (20% off)£23.96
Spend £500+ (30% off)£20.97
Spend £1000+ (50% off)£14.98

 

In stock

Add to Cart
LL37 5MG
LL37 5mg
£29.95

Free shipping on orders over £20

  • Royal Mail Tracked24
  • Order before 16.00 for same day dispatch
  • Money Back Guarantee
Guaranteed Safe Checkout

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden.

LL-37 (ACE)
Certificate of Analysis (representative)

Representative specimen data. These are typical results for this product. Actual results are batch-specific and are printed on the certificate for the batch number on your vial. Research use only.

LL-37 (ACE) — representative Certificate of Analysis (specimen)
ParameterResult
Product nameLL-37 (ACE)
CAS number154947-66-7
Molecular formulaC205H340N60O53
Molecular weight4493.3 g/mol
AppearanceWhite to off-white powder
Test methodRP-HPLC (C18), UV detection at 220 nm
Purity (HPLC)98.50% (specification ≥ 98.0%)
Mass-spec identityESI-MS (positive): [M+3H]3+ 1498.8, confirming 4493.3 g/mol
Water content4.7% (Karl Fischer, specification ≤ 10.0%)
Analysis dateRepresentative specimen — the analysis date is printed on each batch certificate

Download the specimen certificate (PDF)

  • OP Labs formerly Oxford Peptides
  • Batch HPLC tested at 98.5%+ purity
  • Store frozen long term or in fridge when ready to be used
  • Sold for research purposes only
  • Contact us for Wholesale Orders

Search our database for full COA analytics here.

LL-37

Synonyms / Designations: LL-37, CAP-18 (C-terminal fragment), Human Cathelicidin Antimicrobial Peptide
CAS Number: 154947-66-7
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.33 g/mol
Purity: ≥ 98 % (HPLC)
Appearance: White to off-white lyophilised powder
Pack Size: 5 mg (total)
Storage: Desiccated, protected from light, stored at −20 °C or below
Solubility: Soluble in water and buffered aqueous solutions

Description & Mechanism

LL-37 is a 37-amino acid peptide derived from the C-terminal domain of human cathelicidin (hCAP-18). It is the only cathelicidin-derived antimicrobial peptide identified in humans and is widely used as a research tool for investigating innate immune defence mechanisms in experimental systems.

In biochemical and cellular research models, LL-37 has been reported to interact with bacterial membranes and modulate host immune signalling pathways. Observed activities include membrane disruption in microbial models, modulation of inflammatory mediator release, and influence on cell migration and proliferation in in vitro assays. Experimental outcomes are highly dependent on concentration, model system, and assay conditions.

Applications in Research

  • As a molecular tool to study host-defence peptide activity and innate immune signalling
  • Investigation of antimicrobial peptide–membrane interactions in microbial model systems
  • In vitro studies examining immunomodulatory effects on cytokine and chemokine release
  • Preclinical or ex vivo experimental models for mechanistic investigation of cathelicidin biology

Specifications Summary

ParameterTypical Value / Range
Purity (HPLC)≥ 98
AppearanceWhite to off-white lyophilised powder
Molecular Weight4493.33 g/mol
Peptide TypeSynthetic cathelicidin-derived antimicrobial peptide
SolubilityWater, buffered aqueous solutions
Storage−20 °C, desiccated, dark
Pack Size5 mg

Handling, Reconstitution & Stability

  • Weigh under dry conditions; peptide is hygroscopic
  • Reconstitute in sterile water or appropriate buffered aqueous solution depending on assay requirements
  • Avoid vigorous agitation during dissolution
  • Filter sterilize if required (e.g. 0.22 μm) prior to use
  • Aliquot and store reconstituted solutions at −20 °C or below to minimise degradation
  • Avoid repeated freeze–thaw cycles

Precautions & Notes

  • Experimental behaviour of LL-37 is dependent on concentration, model system, and exposure conditions
  • Due to reported interaction with multiple immune signalling pathways, appropriate experimental controls are recommended
  • Prolonged exposure to light, elevated temperature, or aqueous environments may reduce stability
  • Intended strictly for laboratory research use; not for human or veterinary application

References

Vandamme D. et al. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology, 2012.
https://pubmed.ncbi.nlm.nih.gov/22571893/

Kahlenberg J.M. & Kaplan M.J. Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. The Journal of Immunology, 2013.
https://pubmed.ncbi.nlm.nih.gov/24127553/